OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels

Amir Jalali; Frank Bosmans; Mehriar Amininasab; Elke Clynen; Eva Cuypers; Abbas Zaremirakabadi; Mohammad-Nabi Sarbolouki; Liliane Schoofs; Hossein Vatanpour; Jan Tytgat

doi:10.1016/j.febslet.2005.06.052

OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels

Amir Jalali, Frank Bosmans, Mehriar Amininasab, Elke Clynen, Eva Cuypers, Abbas Zaremirakabadi, Mohammad-Nabi Sarbolouki, Liliane Schoofs, Hossein Vatanpour, Jan Tytgat

Farmaceutische en Farmacologische Wetenschappen

Onderzoeksoutput: Article › peer review

54 Citaten (Scopus)

Samenvatting

In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Na(v)1.2/beta1, Na(v)1.5/beta1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC50 = 80+/-14 nM) while Na(v)1.2/beta1 still was not affected at concentrations up to 5 microM. Na(v)1.5/beta1 was influenced at micromolar concentrations.

Originele taal-2	English
Pagina's (van-tot)	4181-4186
Aantal pagina's	6
Tijdschrift	FEBS Letters
Volume	579
Nummer van het tijdschrift	19
DOI's	https://doi.org/10.1016/j.febslet.2005.06.052
Status	Published - 1 aug. 2005

Toegang tot document

10.1016/j.febslet.2005.06.052

Handle.net

Permanente koppeling

Citeer dit

@article{4737aacb00e244f2aa3834ad0ae44cce,

title = "OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels",

abstract = "In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Na(v)1.2/beta1, Na(v)1.5/beta1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC50 = 80+/-14 nM) while Na(v)1.2/beta1 still was not affected at concentrations up to 5 microM. Na(v)1.5/beta1 was influenced at micromolar concentrations.",

keywords = "Amino Acid Sequence, Animals, Ion Channel Gating, Molecular Sequence Data, Neurotoxins/chemistry, Scorpion Venoms/chemistry, Scorpions, Sequence Homology, Amino Acid, Sodium Channels/drug effects, Spectrometry, Mass, Matrix-Assisted Laser Desorption-Ionization",

author = "Amir Jalali and Frank Bosmans and Mehriar Amininasab and Elke Clynen and Eva Cuypers and Abbas Zaremirakabadi and Mohammad-Nabi Sarbolouki and Liliane Schoofs and Hossein Vatanpour and Jan Tytgat",

year = "2005",

month = aug,

day = "1",

doi = "10.1016/j.febslet.2005.06.052",

language = "English",

volume = "579",

pages = "4181--4186",

journal = "FEBS Letters",

issn = "0014-5793",

publisher = "Elsevier",

number = "19",

}

TY - JOUR

T1 - OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels

AU - Jalali, Amir

AU - Bosmans, Frank

AU - Amininasab, Mehriar

AU - Clynen, Elke

AU - Cuypers, Eva

AU - Zaremirakabadi, Abbas

AU - Sarbolouki, Mohammad-Nabi

AU - Schoofs, Liliane

AU - Vatanpour, Hossein

AU - Tytgat, Jan

PY - 2005/8/1

Y1 - 2005/8/1

N2 - In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Na(v)1.2/beta1, Na(v)1.5/beta1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC50 = 80+/-14 nM) while Na(v)1.2/beta1 still was not affected at concentrations up to 5 microM. Na(v)1.5/beta1 was influenced at micromolar concentrations.

AB - In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Na(v)1.2/beta1, Na(v)1.5/beta1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC50 = 80+/-14 nM) while Na(v)1.2/beta1 still was not affected at concentrations up to 5 microM. Na(v)1.5/beta1 was influenced at micromolar concentrations.

KW - Amino Acid Sequence

KW - Animals

KW - Ion Channel Gating

KW - Molecular Sequence Data

KW - Neurotoxins/chemistry

KW - Scorpion Venoms/chemistry

KW - Scorpions

KW - Sequence Homology, Amino Acid

KW - Sodium Channels/drug effects

KW - Spectrometry, Mass, Matrix-Assisted Laser Desorption-Ionization

U2 - 10.1016/j.febslet.2005.06.052

DO - 10.1016/j.febslet.2005.06.052

M3 - Article

C2 - 16038905

SN - 0014-5793

VL - 579

SP - 4181

EP - 4186

JO - FEBS Letters

JF - FEBS Letters

IS - 19

ER -

OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels

Samenvatting

Toegang tot document

Handle.net

Vingerafdruk

Citeer dit